PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa17g025010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family ARF
Protein Properties Length: 1163aa    MW: 128113 Da    PI: 5.7305
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa17g025010.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3314.6e-10126192162
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE- CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvlt 62 
                     f+k+lt sd++++g +++p++ ae++       + +++  ++++ +d++  +W++++iyr  +++ +l+
  Csa17g025010.1 126 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfsM-QPPA-QEIVAKDLHDTTWTFRHIYRDEKSQLMLG 192
                     99*****************************954.4444.48*****************9999998875 PP

2Auxin_resp118.45.9e-39221303183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     aaha +++s+F++++nPras+seFvv+++k++kal+ +vs+GmRf+m+feted+  rr++Gtv+g+sdldpvrW++S+Wr+L+
  Csa17g025010.1 221 AAHANANSSPFTIFFNPRASPSEFVVPLAKYNKALYAQVSLGMRFRMMFETEDCGVRRYMGTVTGISDLDPVRWKGSQWRNLQ 303
                     799******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.4E-29116223IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.9E-21120191IPR015300DNA-binding pseudobarrel domain
CDDcd100172.29E-10125192No hitNo description
PfamPF023622.9E-8126191IPR003340B3 DNA binding domain
SMARTSM010190.0013126221IPR003340B3 DNA binding domain
PfamPF065078.2E-34221303IPR010525Auxin response factor
PfamPF023091.4E-910321120IPR033389AUX/IAA domain
PROSITE profilePS5174524.80110341127IPR000270PB1 domain
SuperFamilySSF542771.77E-810481112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1163 aa     Download sequence    Send to blast
MKAPSNGFLP NSNEGEKKPI NSQLWHACAG PLVSLPPVGS LVVYFPQGHS EQVAASMQKQ  60
TDFIPNYPNL PSKLICLLHS VTLHADTETD EVYAQMTLQP VNKYDREALL ASDMGLKLNR  120
QPTEFFCKTL TASDTSTHGG FSVPRRAAEK IFPPLDFSMQ PPAQEIVAKD LHDTTWTFRH  180
IYRDEKSQLM LGIRRANRQT PTLSSSVISS DSMHIGILAA AAHANANSSP FTIFFNPRAS  240
PSEFVVPLAK YNKALYAQVS LGMRFRMMFE TEDCGVRRYM GTVTGISDLD PVRWKGSQWR  300
NLQVGWDEST AGDRPSRVSI WEIEPVITPF YICPPPFFRP KYPRQPGMPD DELDMENAFK  360
RAMPWMGEEF GMKDAQSSMF PGLSLVQWMS MQQNNPLSGS ATPQLPAALS SYNLPNNFAS  420
NDPSKLAMPW MGEEFGMKDA QSSMFPGLSL VQWMSMQQNN PLSVSCQNPH QSTGFSQSQL  480
QQQSMLPNGA KMTHQNINSA GNKGSSQMTS FAQELQFQQQ LELHNSSQLL RNQQEQSSLH  540
SLQQSLSQNP QQLQMQQQSP KQSPSQQLQL HLLQKLQQQQ QQQQSIPPVS SSLQPQLSAM  600
QQTQSHQLQQ LLSSQNQQPL AHGNNNFSAS TFMQPPQIQV NHQQQGQMNN KPLVAPGRSH  660
SGHTDGEAPS CSTSPSANNT GHDNVSPTNF LSRNQQQGQA VSVSASDSVF ERASNPVQEL  720
YAKTDSRMNQ GMVNLKSAGE QFKFKGAVTD QIDVSTAGTT YCPDVVGSAQ QQQTFPLPSF  780
GFDGDCQSHH PRNNLAFASN LEAVTPDALY SQKDFQNLVP NYGNAPRDIE TELSSAAISS  840
QSFGIPSIPF KLXVSVSASD SVFERASNPV QELYAKTDSR MNQGMVNLKS AGEQFKFKGA  900
VTDQIDVSTA GTTYCPDVVG SAQQQQTFPL PSFGFDGDCQ SHHPRNNLAF ASNLEAVTPD  960
ALYSQKDFQN LVPNYGNAPR DIETELSSAA ISSQSFGIPS IPFKSGCSNE VGGINDSGIM  1020
NGGGLWPNQT QRMRTYTKVQ KRGSVGRSID VTRYSGYDEL RHDLARMFGI EGQLEDPLTS  1080
DWKLVYTDHE NDILLVGDDP WEEFVNCVQN IKILSSAEVQ QMSLDGDLAA IPATNQACSE  1140
TDSGNAWKVH YEDTSAAASF NR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1431532445388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4934670.0AB493467.1 Arabidopsis thaliana At1g19220 mRNA for hypothetical protein, partial cds, clone: RAAt1g19220.
GenBankATU536720.0U53672.2 Arabidopsis thaliana early auxin-induced IAA22 mRNA, complete cds.
GenBankAY0083900.0AY008390.1 Arabidopsis thaliana ARF11/IAA22 gene, complete cds.
GenBankAY6697940.0AY669794.1 Arabidopsis thaliana clone C105352 ARF19 (At1g19220) mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankT29M80.0AC069143.3 Sequence of BAC T29M8 from Arabidopsis thaliana chromosome 1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010477125.10.0PREDICTED: auxin response factor 19
SwissprotQ8RYC80.0ARFS_ARATH; Auxin response factor 19
TrEMBLR0IQP50.0R0IQP5_9BRAS; Auxin response factor
STRINGBra016517.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19